Names & Information

Gene Name
ZS05g0309500
Gene Location
Gene Structure
Protein Name
Alternative splicing
Homology
Best Hit (NR)
Best Hit (SwissProt)
NT seq
Len:1173 nt

ATGTCCGTGCTTACCTGTGTGCTTGATAACATGGGCTCATCCTGTAGCAGATCTCATTCTTTAAGTGAGGCTGAAACAAC
CAAAAATGCAAAATCTGCAGACATTGACAGGCGAATTTTGCAAGAGACAAAAGCAGAGCAACACATCCACAAGCTCTTAC
TTCTTGGTGCGGGAGAATCAGGGAAGTCTACGATATTTAAACAGATTAAGCTCCTTTTCCAAACTGGCTTTGATGAGGCA
GAACTTAGGAGCTACACATCAGTTATCCATGCAAACGTCTATCAGACAATTAAAATACTATATGAAGGAGCAAAAGAACT
CTCACAAGTGGAATCAGATTCCTCAAAGTATGTTATATCGCCAGATAACCAGGAAATTGGAGAAAAACTATCAGATATTG
ATGGCAGGTTGGATTATCCACTGCTGAACAAAGAACTTGTACTCGATGTAAAAAGGTTATGGCAAGACCCAGCCATTCAG
GAAACTTACTTACGTGGAAGTATTCTGCAACTTCCTGATTGTGCACAATACTTCATGGAAAATTTGGATCGATTAGCCGA
AGCAGGTTATGTGCCAACAAAGGAGGATGTGCTTTATGCAAGAGTACGGACAAATGGTGTTGTACAAATACAATTTAGTC
CTGTTGGAGAAAACAAAAGAGGTGGAGAGGTATATAGGTTGTATGATGTAGGAGGCCAGAGGAATGAGAGGAGAAAGTGG
ATTCATCTTTTTGAAGGTGTTAATGCGGTAATCTTTTGTGCTGCCATTAGCGAATATGATCAGATGCTATTTGAAGATGA
GACAAAAAACAGAATGATGGAGACCAAGGAACTCTTTGACTGGGTTTTAAAGCAAAGATGTTTTGAGAAAACATCATTCA
TTCTGTTTCTCAACAAATTTGATATATTCGAGAAGAAAATACAAAAGGTTCCTTTAAGTGTGTGCGAGTGGTTTAAAGAC
TACCAGCCTATTGCACCTGGGAAACAGGAGGTTGAACATGCATATGAGTTTGTCAAGAAGAAGTTTGAAGAGCTCTACTT
CCAGAGCAGCAAGCCTGACCGTGTGGACCGCGTCTTCAAAATCTACAGAACTACGGCCCTAGACCAGAAACTTGTAAAGA
AGACATTCAAGTTGATTGATGAGAGCATGAGACGCTCCAGGGAAGGAACTTGA
AA seq
Len:391 aa

MSVLTCVLDNMGSSCSRSHSLSEAETTKNAKSADIDRRILQETKAEQHIHKLLLLGAGESGKSTIFKQIKLLFQTGFDEA
ELRSYTSVIHANVYQTIKILYEGAKELSQVESDSSKYVISPDNQEIGEKLSDIDGRLDYPLLNKELVLDVKRLWQDPAIQ
ETYLRGSILQLPDCAQYFMENLDRLAEAGYVPTKEDVLYARVRTNGVVQIQFSPVGENKRGGEVYRLYDVGGQRNERRKW
IHLFEGVNAVIFCAAISEYDQMLFEDETKNRMMETKELFDWVLKQRCFEKTSFILFLNKFDIFEKKIQKVPLSVCEWFKD
YQPIAPGKQEVEHAYEFVKKKFEELYFQSSKPDRVDRVFKIYRTTALDQKLVKKTFKLIDESMRRSREGT*
Expression(FPKM)

Other Prediction

>Subcell

Subcell Location Prediction : Name Prediction Smen-score D-score SP

ZS05t0309500-01 Plasma Membrane 0.125 0.133 N

>PPI

Protein-Protein Interaction Prediction : Protein1 Protein2 Method Source

show more