Names & Information

Gene Name
ZS01g0093800
Gene Location
Gene Structure
Protein Name
Alternative splicing
Homology
Best Hit (NR)
Best Hit (SwissProt)
NT seq
Len:1692 nt

ATGAAGCAAGAGCAGGTCAGGATGGCAGTGCTCCTCATGCTCAACTGCTTCGTCAAGGCCACGGCGCCGCCGCCATGGCC
GCCGTCGGCTTCGTCCGCCTCCTTCCTCGACGACCTCGGCGACCTCGGCATCGCGCCGCTCATCCGCGCCGACGAGGCGG
CCACCGCGCGCGCCTCCGCCGACTTTGGCAACCTCTCCGTCGCCGGCGTCGGGGCGCCTCGGCTCGCCGCCGCCGTGCTC
TACCCGTCGCGCCCCGCCGACATCGCCGCGCTGCTGCGCGCGTCGTGCGCACGCCCGGCGCCGTTCGCGGTGTCCGCGCG
GGGGTGTGGCCACTCGGTGCGCGGCCAGGCCTCCGCGCCCGACGGCGTCGTCGTCGACATGGCGTCGCTCGGCCGCCTGC
AGGGCGGCGGCGCGCGGCGCCTCGCCGTGTCAGTGGAGGGGCGGTACGTCGACGCCGGCGGCGAGCAGCTGTGGGTGGAC
GTGCTGCGCGCGTCCATGGCGCACGGGCTCACGCCGGTGTCGTGGACAGACTACCTCCACCTCACCGTCGGCGGCACGCT
GTCCAACGCCGGCATCAGCGGCCAGGCCTTCCGCCATGGCCCCCAGATTTCCAACGTGCTAGAGCTCGACGTCATCACCG
GTGTCGGGGAGATGGTGACGTGCTCGAAGGAGAAGGCGCCGGACCTGTTCGACGCGGTGCTGGGCGGGCTGGGGCAGTTC
GGCGTCATCACGCGGGCGCGCATCCCGCTCGCGCCGGCGCCGGCGAGGGCGCGGTGGGTGCGGTTCGTGTACACGACGGC
GGCGGCGATGACGGCCGACCAGGAGCGCCTCATCGCCGTCGATCGCGCCGGCGGCGCCGGCGCGGTGGGCGGGCTGATGG
ACTACGTCGAGGGCTCGGTCCACCTGAACCAGGGCCTGGTCGAGACCTGGCGCACGCAGCCGCAGCCGCCTTCGCCGTCC
TCCTCCTCCTCCTCATCCTTCTTCTCCGACGCCGACGAGGCCCGCGTCGCCGCGCTCGCCAAGGAGGCCGGCGGCGTGCT
GTATTTCCTCGAGGGCGCCATCTACTTCGGCGGCGCCGCCGGGCCGTCCGCCGCCGACGTTGACAAGAGGATGGATGTGC
TGCGTCGCGAGCTGCGGCACGAGCGCGGGTTCGTGTTCGCGCAGGACGTGGCGTACGCCGGGTTCCTGGACCGCGTCCAC
GACGGCGAGCTCAAGCTCCGCGCCGCGGGGCTCTGGGACGTGCCGCACCCATGGCTGAACCTGTTCCTCCCCCGCTCCGG
CGTCCTCGCCTTCGCCGACGGCGTCTTCCACGGCATCCTCAGCCGCACCCCCGCCATGGGCCCCGTCCTCATCTACCCCA
TGAACCGCAACAAGTGGGACAGTAACATGTCGGCAGTGATCACCGACGACGACGGTGACGAGGTGTTCTACACGGTGGGG
ATCCTGCGGTCGGCGGCGGCGGCCGGCGACGTGGGGAGGCTGGAGGAGCAGAACGACGAGATCTTGGGTTTCTGCGAGGT
GGCCGGGATAGCCTACAAGCAGTACCTGCCTTACTACGGCAGCCAGGCAGAGTGGCAGAAGCGGCACTTCGGTGCCAAGC
TCTGGCCAAGATTCGTGCAGCGGAAGAGCAAGTATGATCCAAAGGCCATCCTGTCCCGTGGCCAGGGGATTTTCACGTCA
CCACTCGCATGA
AA seq
Len:564 aa

MKQEQVRMAVLLMLNCFVKATAPPPWPPSASSASFLDDLGDLGIAPLIRADEAATARASADFGNLSVAGVGAPRLAAAVL
YPSRPADIAALLRASCARPAPFAVSARGCGHSVRGQASAPDGVVVDMASLGRLQGGGARRLAVSVEGRYVDAGGEQLWVD
VLRASMAHGLTPVSWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVLELDVITGVGEMVTCSKEKAPDLFDAVLGGLGQF
GVITRARIPLAPAPARARWVRFVYTTAAAMTADQERLIAVDRAGGAGAVGGLMDYVEGSVHLNQGLVETWRTQPQPPSPS
SSSSSSFFSDADEARVAALAKEAGGVLYFLEGAIYFGGAAGPSAADVDKRMDVLRRELRHERGFVFAQDVAYAGFLDRVH
DGELKLRAAGLWDVPHPWLNLFLPRSGVLAFADGVFHGILSRTPAMGPVLIYPMNRNKWDSNMSAVITDDDGDEVFYTVG
ILRSAAAAGDVGRLEEQNDEILGFCEVAGIAYKQYLPYYGSQAEWQKRHFGAKLWPRFVQRKSKYDPKAILSRGQGIFTS
PLA*
Expression(FPKM)

Other Prediction

>Subcell

Subcell Location Prediction : Name Prediction Smen-score D-score SP

ZS01t0093800-01 Nuclear 0.673 0.614 Y

>PPI

Protein-Protein Interaction Prediction : Protein1 Protein2 Method Source

show more