Names & Information

Gene Name
MH06g0580600
Gene Location
Gene Structure
Protein Name
Alternative splicing
Homology
Best Hit (NR)
Best Hit (SwissProt)
NT seq
Len:1935 nt

ATGCATGAGAGTGATGAGCTGCTTCTGCTTGTTGCCTTCCTCACTTTGGGCATTTCTCTCTCGCCTTCCTGTCCATTGCT
GGCCTTATGTGAGGGTTGGAAGCAAGGGATCTCTGCATGCTGTGGTTGCATGACACAGATGCACATGTCCCTTTTGGTGG
GTAATGATGGGGTGCAGGTGGAGGTGATGATAGATTGCCTCATCTGGGGACTGAGACATTCCATCCAAGGGTGCCCAATG
CCATGCCCTCACATTCACTCACAGCTAGTAGAGCTATCCCCCTCCCCTCCCCTCCCCTCTTTGCAATATTCCATTTGTTT
GCTAATGTGTTGTATCAAGATGCCCTTGATTTATCTGGAGGCCATCATCAATGAAGATCCCACCAAGGGACAAAACATGA
GATGGTTGGAGAGTTGGGAAGCTGCAATTGCAAGCCCAGATGTTGGACGTGCACGCTCGCCCTCCCTATTAAACCCGCCC
TCCTCCGATGCTCCCTCTCCTCCTCCCCCCTCGCCGCCGCCGCCGCCACCTTCTCCGGCAGCTCACCGTCGTTGTAGTAG
CTCTGGTGGTGGTGGTGGTGACGACGACGGCTACGGCGGCGGCGACGGCATGCTCCGGTCACTCCACTCCTCGTCGTCTT
CTGACACGGATAACAACAGCGGTGGCTGCAAGAACAATGGCGGCGGCGGTGGCGAGGCCGCCGCCGCCGTTGAGGGTGGC
GGTGATCAGCGTGCCGTTGCGGCGGCGGCGCCGTCGACGCGGGACTTGCTGCTGGCGTGCGCGGACCTGCTGCAGAGGGG
GGACCTGCCGGCGGCGAGGCGCGCGGCGGAGATCGTCTTGGCGGCGGCGGCGTCGCCGCGGGGCGACGCGGCGGACCGCC
TGGCGTACCACTTCGCCCGCGCGCTGGCGCTCCGGGTGGACGCCAAGGCCGGCCATGGCCACGTCGTCGTCGGCGGCGGC
GCGGCGCGGCCGGCGTCGTCCGGGGCGTACCTGGCGTTCAACCAGATCGCGCCGTTCCTGCGGTTCGCGCACCTCACGGC
GAACCAGGCCATCCTCGAGGCCGTCGACGGCGCGCGCCGCGTCCACATCCTCGACCTCGACGCCGTCCACGGCGTGCAGT
GGCCGCCGCTGCTGCAGGCCATCGCCGAGCGCGCGGACCCGGCGCTCGGCCCGCCCGAGGTCCGCGTCACCGGCGCCGGC
GCCGACCGCGACACCCTCCTCCGCACCGGCAACCGCCTCCGCGCCTTCGCCCGCTCCATCCACCTCCCCTTCCACTTCAC
CCCGCTCCTCCTCTCCTGCGCCACCACGGCGCCCCACCACGTCGCCGGCACGAGCACCGGCGCCGCCGCCACCGCCTCGA
CCGCCGCCGCCGCCACCGGCCTCGAGTTTCACCCGGACGAGACGCTCGCCGTGAACTGCGTCATGTTCTTGCACAACCTG
GCCGGCCACGACGAGCTCGCCGCGTTCTTGAAGTGGGTGAAGGCCATGTCGCCCGCCGTGGTGACCATCGCCGAGAGGGA
AGCAGGCGGCGGCGGCGGCGGCGGCGACCACATCGACGACCTGCCGCGGCGGGTCGGGGTGGCCATGGATCACTACTCGG
CGGTGTTCGAGGCGCTGGAGGCGACGGTGCCGCCGGGGAGCCGGGAGCGCCTCGCCGTGGAGCAGGAGGTGCTGGGCCGG
GAGATCGAGGCCGCGGTGGGGCCCTCCGGCGGCCGGTGGTGGCGCGGCATCGAGCGGTGGGGCGGCGCCGCCCGCGCCGC
GGGGTTCGCGGCGCGGCCGCTCAGCGCGTTCGCCGTGTCGCAGGCGCGGCTGCTGCTCCGGCTGCACTACCCGTCGGAGG
GCTACCTCGTGCAGGAGGCGCGCGGCGCCTGCTTCCTGGGGTGGCAGACGCGCCCGCTGCTCTCCGTCTCAGCGTGGCAG
CCGTCGTCGTCGTAG
AA seq
Len:645 aa

MHESDELLLLVAFLTLGISLSPSCPLLALCEGWKQGISACCGCMTQMHMSLLVGNDGVQVEVMIDCLIWGLRHSIQGCPM
PCPHIHSQLVELSPSPPLPSLQYSICLLMCCIKMPLIYLEAIINEDPTKGQNMRWLESWEAAIASPDVGRARSPSLLNPP
SSDAPSPPPPSPPPPPPSPAAHRRCSSSGGGGGDDDGYGGGDGMLRSLHSSSSSDTDNNSGGCKNNGGGGGEAAAAVEGG
GDQRAVAAAAPSTRDLLLACADLLQRGDLPAARRAAEIVLAAAASPRGDAADRLAYHFARALALRVDAKAGHGHVVVGGG
AARPASSGAYLAFNQIAPFLRFAHLTANQAILEAVDGARRVHILDLDAVHGVQWPPLLQAIAERADPALGPPEVRVTGAG
ADRDTLLRTGNRLRAFARSIHLPFHFTPLLLSCATTAPHHVAGTSTGAAATASTAAAATGLEFHPDETLAVNCVMFLHNL
AGHDELAAFLKWVKAMSPAVVTIAEREAGGGGGGGDHIDDLPRRVGVAMDHYSAVFEALEATVPPGSRERLAVEQEVLGR
EIEAAVGPSGGRWWRGIERWGGAARAAGFAARPLSAFAVSQARLLLRLHYPSEGYLVQEARGACFLGWQTRPLLSVSAWQ
PSSS*
Expression(FPKM)

Other Prediction

>Subcell

Subcell Location Prediction : Name Prediction Smen-score D-score SP

MH06t0580600-01 Nuclear 0.861 0.662 Y

>PPI

Protein-Protein Interaction Prediction : Protein1 Protein2 Method Source

show more